Skip to content

hlasimpk/af3_mmseqs_scripts

Folders and files

NameName
Last commit message
Last commit date

Latest commit

 

History

24 Commits
 
 
 
 
 
 
 
 
 
 
 
 
 
 

Repository files navigation

AlphaFold3 MMseqs2 Scripts

Scripts to add MMseqs2 MSA/templates to an AlphaFold3 input JSON and/or add custom template files

Table of Contents

Installation

To install the required dependencies, run:

pip install -r requirements.txt

Usage

These scripts are designed to take in a prepared AlphaFold3 JSON files, e.g.:

{
  "name": "2PV7",
  "sequences": [
    {
      "protein": {
        "id": ["A", "B"],
        "sequence": "GMRESYANENQFGFKTINSDIHKIVIVGGYGKLGGLFARYLRASGYPISILDREDWAVAESILANADVVIVSVPINLTLETIERLKPYLTENMLLADLTSVKREPLAKMLEVHTGAVLGLHPMFGADIASMAKQVVVRCDGRFPERYEWLLEQIQIWGAKIYQTNATEHDHNMTYIQALRHFSTFANGLHLSKQPINLANLLALSSPIYRLELAMIGRLFAQDAELYADIIMDKSENLAVIETLKQTYDEALTFFENNDRQGFIDAFHKVRDWFGDYSEQFLKESRQLLQQANDLKQG"
      }
    }
  ],
  "modelSeeds": [1],
  "dialect": "alphafold3",
  "version": 1
}

And modify them so that they contain MSAs and/or templates generated by MMseqs2. This allows AlphaFold3 to skip it's internal MSA generating step and jump straight to the model inference step.

Adding MMseqs2 MSAs and templates

To add MMseqs2 MSAs and templates to the AlphaFold3 input JSON, you can use the add_mmseqs_msa.py script.

With Templates

To run the script with templates, use the following command:

python add_mmseqs_msa.py --input_json <input_json> --output_json <output_json> --templates --num_templates <num_templates>
  • <input_json>: Path to the input AlphaFold3 JSON file.
  • <output_json>: [optional] Path to the output JSON file (default: <input_json_stem>_mmseqs.json).
  • <num_templates>: [optional] The number of templates to use (default: 20)

Without Templates

To run the script without templates, use the following command:

python add_mmseqs_msa.py --input_json <input_json> --output_json <output_json>
  • <input_json>: Path to the input AlphaFold3 JSON file.
  • <output_json>: [optional] Path to the output JSON file (default: <input_json_stem>_mmseqs.json).

Adding custom templates

You may wish to add custom templates to your AlphaFold3 job, e.g. homologues which have yet to be deposited in the PDB. You can do so in two ways:

add_custom_template.py

If you just wish to add a custom template, you can use add_custom_template.py:

python add_custom_template.py --input_json <input_json> --output_json <output_json> --custom_template <custom_template> --custom_template_chain <custom_template_chain> --target_id <target_id>
  • <input_json>: Path to the input AlphaFold3 JSON file.
  • <output_json>: [optional] Path to the output JSON file (default: <input_json_stem>_custom_template.json).
  • <custom_template> : Path to the custom template file in mmCIF format.
  • <custom_template_chain> : [conditionally required] The chain ID of the chain to use in your custom template, only required if using a multi-chain template.
  • <target_id> : [conditionally required] The ID of the sequence the custom template relates to, only required if modelling a complex.

add_mmseqs_msa.py

If you wish to add a custom template and generate an MMseqs2 MSA/templates, you can use add_mmseqs_msa.py:

python add_mmseqs_msa.py --input_json <input_json> --output_json <output_json> --templates --num_templates <num_templates> --custom_template <custom_template> --custom_template_chain <custom_template_chain> --target_id <target_id>
  • <input_json>: Path to the input AlphaFold3 JSON file.
  • <output_json>: [optional] Path to the output JSON file (default: <input_json_stem>_mmseqs.json).
  • <num_templates>: [optional] The number of templates to use (default: 20)
  • <custom_template> : Path to the custom template file in mmCIF format.
  • <custom_template_chain> : [conditionally required] The chain ID of the chain to use in your custom template, only required if using a multi-chain template.
  • <target_id> : [conditionally required] The ID of the sequence the custom template relates to, only required if modelling a complex.

Running AlphaFold3

alphafold3.py

This file has the functionality of the above two scripts above and runs alphafold3 directly. Please make sure you have the AlphaFold3 on your system (Instructions here and have procured the model parameters and the databases.

python alphafold3.py <input_json>  <output_dir> --model_params <model_params> --database <database> 
--mmseqs2 --num_templates <num_templates> --custom_template <custom_template> --custom_template_chain <custom_template_chain> --target_id <target_id>
  • <input_json>: Path to the input AlphaFold3 JSON file.
  • <output_dir>: Path to the output directory.
  • <model_params>: Path to the directory containing the AlphaFold3 model parameters.
  • <database>: Path to the directory containing the databases #Note: This is not used if using the --mmseqs2 flag but I think it is required by the alphafold3.py script.
  • <num_templates>: [optional] The number of templates to use (default: 20)
  • <custom_template> :[optional] Path to the custom template file in mmCIF format.
  • <custom_template_chain> : [conditionally required] The chain ID of the chain to use in your custom template, only required if using a multi-chain template.
  • <target_id> : [conditionally required] The ID of the sequence the custom template relates to, only required if modelling a complex.

Common Issues

Using --target_id with homo-oligomer

Below is an example of a hetero-3-mer. When modelling a homo-oligomer, id is given as a list, you should select 1 of the identifiers in the list.

{
  "name": "7ZYH",
  "sequences": [
    {
      "protein": {
        "id": "A",
        "sequence": "SNAESKIKDCPWYDRGFCKHGPLCRHRHTRRVICVNYLVGFCPEGPSCKFMHPRFELPMGTTEQ"
      }
    },
    {
      "protein": {
        "id": ["B", "C"],
        "sequence": "SNAGSINGVPLLEVDLDSFEDKPWRKPGADLSDYFNYGFNEDTWKAYCEKQKRIRMGLEVIPVTSTTNK"
      }
    }
  ],
  "modelSeeds": [1],
  "dialect": "alphafold3",
  "version": 1
}

If you want to add a custom template to the first sequence, you can use --target_id A. If you wish to add a custom template to the second sequence, use --target_id B or --target_id C.

Contributing

Contributions are welcome! Please open an issue or submit a pull request.

About

Scripts to add mmseqs MSA/templates to alphafold3 input json and also custom template files

Resources

Stars

22 stars

Watchers

2 watching

Forks

Releases

No releases published

Packages

 
 
 

Contributors

Languages